PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587317.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 314aa    MW: 35070.3 Da    PI: 7.5033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587317.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.2e-182168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++ +k+ G g+W++ ++  g+ R++k+c++rw +yl
   XP_009587317.1 21 KGPWTPEEDEKLIQFIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 68
                     79******************************99************97 PP

2Myb_DNA-binding41.82.5e-1374119148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
   XP_009587317.1  74 RGPFSLDEQKLVIQLHGFLGNR-WAAIASQLP-GRTDNEIKNLWNTHL 119
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-251271IPR009057Homeodomain-like
PROSITE profilePS5129424.9891672IPR017930Myb domain
SuperFamilySSF466898.39E-3018115IPR009057Homeodomain-like
SMARTSM007171.2E-142070IPR001005SANT/Myb domain
PfamPF002491.6E-162168IPR001005SANT/Myb domain
CDDcd001671.24E-112368No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2372123IPR009057Homeodomain-like
SMARTSM007172.8E-1273121IPR001005SANT/Myb domain
PROSITE profilePS5129416.4573123IPR017930Myb domain
PfamPF002492.3E-1274119IPR001005SANT/Myb domain
CDDcd001671.79E-876119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MCMREGGMGR IPCCDKNGLK KGPWTPEEDE KLIQFIKKNG HGSWRSLPKL AGLLRCGKSC  60
RLRWTNYLRP DIKRGPFSLD EQKLVIQLHG FLGNRWAAIA SQLPGRTDNE IKNLWNTHLK  120
KHLLSMGIDP DTHEPSSASN GLLRRPPTST SARHMAQWES ARLEAEARLS RESQLLVPSS  180
VERSDTDHFL RMWNSEIGET FRKFKNREKT DSQSRASQAS SCTKYGSASG ITTEVELGGV  240
AGSPVTGSNQ NEYTEWKNGQ PHTEDILQGS ETSSCNALED SSESALQLLL DFPSNNDLSF  300
LGHSDSCSMY PFLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28191235108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587317.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLM0ZG360.0M0ZG36_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000000940.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-123myb domain protein 17